PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g022360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family VOZ
Protein Properties Length: 467aa    MW: 52027.3 Da    PI: 5.3815
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g022360.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4098.9e-1261874061217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                       pppsaflgpkcalwdc+rpa gs+w+q   dycs +ha+la neg +g  pv+rp g++lkd+llf+alsak++gk+vg+pec gaatakspw
  Sopen02g022360.1 187 PPPSAFLGPKCALWDCPRPAMGSDWCQkshDYCSDYHAALAPNEGYLGRPPVVRPMGVGLKDSLLFQALSAKAHGKDVGVPECRGAATAKSPW 279
                       89***********************976668************************************************************** PP

               VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalaly 183
                       na+elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqv++++gglkrsyymdpqp++++ewhlyeyein++da aly
  Sopen02g022360.1 280 NAPELFDLEVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVINDYGGLKRSYYMDPQPMKNLEWHLYEYEINKYDAWALY 372
                       ********************************************************************************************* PP

               VOZ 184 rlelklvdekksakgkvskdsladlqkklgrlta 217
                       rlelklvd+kks+kgkv+++s+adlqk++grl+a
  Sopen02g022360.1 373 RLELKLVDGKKSPKGKVMNESVADLQKQMGRLSA 406
                       ********************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MGKGSKNGAL FKDKAKNRVD DLQGMFMNLQ SARKESRTHD AGVLEEQVHQ MLREWKAELN  60
EPSPASSLQG GSRISSDLYR LLHGEEEDDA TSALAAPKPE PDSQKQDVTG FQEGFNATPV  120
MQEQGYQLVD ECKNTPLAVN NAGINNQGVA TQLDYHSFDL QQDFDQFGFD ALNLCLEENL  180
SPIQISPPPS AFLGPKCALW DCPRPAMGSD WCQKSHDYCS DYHAALAPNE GYLGRPPVVR  240
PMGVGLKDSL LFQALSAKAH GKDVGVPECR GAATAKSPWN APELFDLEVV EGETIREWLF  300
FDKPRRAFES GNRKQRSLPD YNGRGWHESR KQVINDYGGL KRSYYMDPQP MKNLEWHLYE  360
YEINKYDAWA LYRLELKLVD GKKSPKGKVM NESVADLQKQ MGRLSADIPL ENKRSAKGRG  420
KANSKDVVTN GPPAPNQTVP SIEGFDYVAG APFPDYLVDN IGGYYIT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065974.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_015065975.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLK4B8X10.0K4B8X1_SOLLC; Uncharacterized protein
STRINGSolyc02g077450.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein